A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10889 |
Swiss-prot Accession number | P21563 (Sequence in FASTA format) |
Description | Insulin precursor [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Rodentia sp. |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;unclassified rodents. |
Subcellular location | Secreted. Note=Stored in spherulous cells prior to secretion |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 108 Amino acids |
Molecular weight | 11849 |
References | 1 PubMed abstract 2531072 2 Bairoch A., Duret L.; Unpublished observations (FEB-1996). 3 Mueller W.E.G.; Unpublished observations (APR-1996). |
Domain Name | Insulin |
Hormone Name | Insulin B chain |
Mature Hormone Sequence | FVNQHLCGSHLVEALYILVCGERGFFYTPMS |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (24-54) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10890 |
Swiss-prot Accession number | P21563 (Sequence in FASTA format) |
Description | Insulin precursor [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Rodentia sp. |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;unclassified rodents. |
Subcellular location | Secreted. Note=Stored in spherulous cells prior to secretion |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 108 Amino acids |
Molecular weight | 11849 |
References | 1 PubMed abstract 2531072 2 Bairoch A., Duret L.; Unpublished observations (FEB-1996). 3 Mueller W.E.G.; Unpublished observations (APR-1996). |
Domain Name | Insulin |
Hormone Name | Insulin A chain |
Mature Hormone Sequence | IVQQCTSGICSLYQENYCN |
Position of mature hormone in Pre-Hormone protein | 19 Residues from position (90-108) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |